en · de · pt
bench-notes.peptides6823.com › Wiki › Tb-500 Identity And Molecular Background — Worked Examples

Tb-500 Identity And Molecular Background — Worked Examples

By Editorial Desk · published 2025-12-16 · last reviewed 2026-01-17 · Wiki

The short version of reconstitution fits in a sentence. The long version — which is the one that helps — is below.

Reviewed 2026-01-17. Anything still debated is marked as such rather than presented as settled.

TB-500 Identity and Molecular Background

Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.

Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.

Identity And Naming Background

Literature and online discussion often conflate TB-500 with full-length thymosin beta-4, even though the two differ in size and are not interchangeable in analytical terms. The fragment is produced by solid-phase peptide synthesis, and the product is a defined seven-residue chain rather than a biological extract. Because the term is a trade-style label, two vendors may supply materials of the same nominal sequence but different counter-ion content, purity, or water content. Comparisons across studies are therefore difficult unless the exact sequence and purity are reported.

TB-500 is a research peptide whose sequence matches residues 17 to 23 of thymosin beta-4, a 43-residue protein present in most mammalian cells. The chain is seven amino acids long, written as LKKTETQ, and is normally supplied with an acetyl group on the N-terminus. Suppliers list it as a lyophilised powder under the code name TB-500, and the same sequence appears elsewhere in catalogues as the thymosin beta-4 actin-binding fragment. The label is commercial rather than systematic, so no single authority fixes exactly what TB-500 denotes.

Thymosin beta-4 was isolated from calf thymus in the early 1980s and later characterised as an abundant intracellular actin-sequestering protein. Interest in short synthetic fragments grew once the actin-binding motif had been mapped to the middle of the sequence. TB-500 came out of that line of work as a truncated analogue rather than a natural isolate, and it is now sold mainly to laboratories. Published studies on the fragment have been largely in vitro or in animal models, and controlled human trials remain sparse, so claims about effects in people rest on extrapolation.

Tb-500 at a glance

PropertyValueNotes
Molecular formulaC38H68N10O14Calculated for the acetylated heptapeptide
Molecular weight~889 DaMonoisotopic mass approximately 889.0 Da
Amino acid sequenceAc-LKKTETQN-terminal acetylated seven-residue peptide
AppearanceWhite to off-white powderTypically supplied as a lyophilized solid
Solubility classWater-solublePeptides of this size generally dissolve in aqueous media

Storage and Analytical Verification

Identity and purity are normally assessed with reversed-phase high-performance liquid chromatography, paired with mass spectrometry to confirm molecular mass. A certificate of analysis reports a purity percentage, usually derived from chromatographic peak area, but that figure does not by itself prove a correct sequence or the absence of counterions. Independent verification may include amino acid analysis or peptide mapping. Batch-to-batch variation is a documented concern in the research chemical market, and the gap between a quoted purity value and actual peptide content can be substantial when the material is a salt or retains residual water.

Lyophilized peptide arrives as a dry cake that should stay sealed until use. Reconstitution is generally performed with sterile water or a buffered solution, and the resulting liquid should be handled gently to limit mechanical stress. Repeated freeze-thaw cycles are widely described as harmful to short peptides, so dividing a reconstituted batch into single-use portions is a common practice. Laboratories also record the solvent, concentration, and date of preparation on the vial label to keep later measurements traceable.

Related pages on this site

TB-500 Background and Identity

The most frequently cited identity is a seven-residue fragment with the sequence LKKTETQ, taken from the actin-binding domain of the parent protein. A separate molecule, N-acetyl-seryl-aspartyl-lysyl-proline, often shortened to Ac-SDKP, derives from the same protein's N-terminal region and appears in overlapping literature. Reported molecular masses therefore differ between sources, and a mass value on its own does not establish which fragment is present. Confirmation requires a defined sequence rather than a single number.

Research interest in thymosin beta-4 fragments centres on actin sequestration, cell migration and tissue repair models. Most published work uses cultured cells or animal wound and cardiac preparations, and findings are generally described as preliminary. No fragment of this protein has been approved as a therapeutic product by major regulators. Reviews of the field note inconsistent dosing, delivery routes and outcome measures across studies, which complicates direct comparison. The material is best understood as a laboratory reagent with an active but unresolved research literature.

TB-500 is a catalogue name applied to a synthetic peptide related to thymosin beta-4, an actin-binding protein found in most mammalian cells. Suppliers do not use the label consistently: some describe it as the full 43-residue protein, others as a short fragment from the actin-binding region, and others as a related tetrapeptide. Because the name is commercial rather than chemical, two products sold under it may not contain the same molecule. This naming ambiguity is the first point to check in any description of the material.

Background from the literature

Plants and animals alike both use small polypeptides for signaling in cell-to-cell communication. CLAVATA3/Embryo Surrounding Region-Related, also known as a plant peptide hormone, signaling is important for cell to cell signaling but also long distance communication. These two actions are especially important for plant cells because they are stationary and must perform cell expansion. In multicellular organisms, cell-to-cell communication has been found to be very crucial for many growth processes that occur inside the organism. The 12 or 13 amino acid polypeptides are the mature forms of the CLE proteins that are derived from the conserved CLE domains. More and more CLE genes are being identified with more research being conducted in this area. CLE genes have not only been found in seed plants but also in lycophytes, bryophytes, and green algae.

The omega oxygenases metabolize fatty acids (RH) by adding a hydroxyl (OH) to their terminal (i.e. furthest from the fatty acids' carboxy residue) carbons; in the reaction, the two atoms of molecular oxygen(O2[ are reduced to one hydroxyl group and one water (H2O molecule) by the concomitant oxidation of NAD(P)H (see monooxygenase). CYP450 enzymes belong to a superfamily which in humans is composed of at least 57 CYPs; within this superfamily, members of six CYP4A subfamilies, (which are CYP4A, CYP4B, CYP4F, CYP4V, CYP4X, and CYP4z) possess ω-hydroxylase activity viz., CYP4A, CYP4B, and CYP4F CYP2U1 also possesses ω hydroxylase activity. These CYP ω-hydroxylases can be categorized into several groups based on their substrates and consequential function

The 5,10-methenyltetrahydromethanopterin hydrogenase (or Hmd), the so-called iron-sulfur cluster-free hydrogenase, is an enzyme found in methanogenic archea such as Methanothermobacter marburgensis. It was discovered and first characterized by the Thauer group at the Max Planck Institute in Marburg. Hydrogenases are enzymes that either reduce protons or oxidize molecular dihydrogen.

Haplotype refers to a group of genetic variants inherited together on a chromosome from one parent due to their genetic linkage. Haplotype phasing (also called haplotype estimation) refers to the process of reconstructing individual haplotypes, important for determining the genetic basis of diseases. Linked-read sequencing allows consistent coverage of genes related to different diseases, helping scientists to obtain all the regions carrying mutations from targeted genes. For example, in 2018, a group of researchers used linked-read sequencing technology to sequence genetic information from a pregnant woman who was a carrier of Duchenne muscular dystrophy (DMD) mutation. Linked-read sequencing allows them to identify the maternal haplotypes and determine the presence of the mutant alleles in the foetal DNA. This non-invasive prenatal diagnosis of DMD demonstrates the clinical applicability of linked-read sequencing.

An antibody–drug conjugate consists of three components: Antibody - targets the cancer cell surface and may also elicit a therapeutic response. Payload - elicits the desired therapeutic response. Linker - attaches the payload to the antibody and should be stable in circulation only releasing the payload at the desired target. Multiple approaches to conjugation have been developed for attachment to the antibody and reviewed. DAR is the drug to antibody ratio and indicates the level of loading of the payload on the ADC.

Sources: en.wikipedia.org

Reference notes

β-pleated sheet structures are made from extended β-strand polypeptide chains, with strands linked to their neighbours by hydrogen bonds. Due to this extended backbone conformation, β-sheets resist stretching. β-sheets in proteins may carry out low-frequency accordion-like motion as observed by the Raman spectroscopy and analyzed with the quasi-continuum model. A β-helix is formed from repeating structural units consisting of two or three short β-strands linked by short loops. These units "stack" atop one another in a helical fashion so that successive repetitions of the same strand hydrogen-bond with each other in a parallel orientation. See the β-helix article for further information. In lefthanded β-helices, the strands themselves are quite straight and untwisted; the resulting helical surfaces are nearly flat, forming a regular triangular prism shape, as shown for the 1QRE archaeal carbonic anhydrase at right. Other examples are the lipid A synthesis enzyme LpxA and insect antifreeze proteins with a regular array of Thr sidechains on one face that mimic the structure of ice.

Tranexamic acid can be used in skincare products as a cosmetic active to reduce the appearance of inflammation and hyperpigmentation. Tranexamic acid is a zwitterion amino acid, and has a low permeability coefficient in the stratum corneum. Tranexamic acid can be combined with penetration enhancers and microneedling to overcome this limitation. Cosmetic uses may also employ lipophilic derivatives of tranexamic acid (ester prodrugs like Cetyl tranexamate mesylate) that are not zwitterionic and thus have improved skin permeability. Allergic to tranexamic acid History of seizures History of venous or arterial thromboembolism or active thromboembolic disease Severe kidney impairment due to accumulation of the medication, dose adjustment is required in mild or moderate kidney impairment

A clinical data management system (CDMS) is a tool used in clinical research to manage the data of a clinical trial. The clinical trial data gathered at the investigator site in the case report form are stored in the CDMS. To reduce the possibility of errors due to human entry, the systems employ various means to verify the data. Systems for clinical data management can be self-contained or part of the functionality of a CTMS. A CTMS with clinical data management functionality can help with the validation of clinical data as well as helps the site employ for other important activities like building patient registries and assist in patient recruitment efforts. The CDMS can be broadly divided into paper-based and electronic data capture systems.

Immunomodulating agents regulate the immune system's response and are produced by various immune cells. These agents include the following agents and markers: The BCG vaccine has been used against tuberculosis, mycobacteria, and various cancers in the form of vaccination as an initial immune system stimulant. In cancer, the anti-tumor immunological effects are elicited by the host's immune response and the BCG infection against the tumor cells, most commonly in bladder cancer. The immune activation allows for further recognition and elimination of malignant tumor cells. Specific active immunotherapy administers a specific antigen as the therapy. The therapy allows the host to create an antigen-specific response with the development of antibodies, proliferation of cytotoxic T lymphocyte responses, or both, directed at the desired pathogen or malignant tumor cell in the case of cancer therapy.

In 1997, Roberts and Szostak showed that fusions between a synthetic mRNA and its encoded myc epitope could be enriched from a pool of random sequence mRNA-peptide fusions by immunoprecipitation. Nine years later, Fukuda and colleagues chose mRNA display method for in vitro evolution of single-chain Fv (scFv) antibody fragments. They selected six different scFv mutants with five consensus mutations. However, kinetic analysis of these mutants showed that their antigen-specificity remained similar to that of the wild type. However, they have demonstrated that two of the five consensus mutations were within the complementarity determining regions (CDRs). And they concluded that mRNA display has the potential for rapid artificial evolution of high-affinity diagnostic and therapeutic antibodies by optimizing their CDRs. Roberts and coworkers have demonstrated that unnatural peptide oligomers consisting of an N-substituted amino acid can be synthesized as mRNA-peptide fusions. N-substituted amino acid-containing peptides have been associated with good proteolytic stability and improved pharmacokinetic properties. This work indicates that mRNA display technology has the potential for selecting drug-like peptides for therapeutic usage resistant to proteolysis.

Sources: en.wikipedia.org

Reference notes

When multiple antibodies are present, or when an antibody is directed against a high-frequency antigen, the normal antibody panel procedure may not provide a conclusive identification. In these cases, hemagglutination inhibition can be used, wherein a neutralizing substance cancels out a specific antigen. Alternatively, the plasma may be incubated with cells of known antigen profiles in order to remove a specific antibody (a process termed adsorption); or the cells can be treated with enzymes such as ficain or papain which inhibit the reactivity of some blood group antibodies and enhance others. The effect of ficain and papain on major blood group systems is as follows: Enhanced: ABO, Rh, Kidd, Lewis, P1, Ii Destroyed: Duffy (Fya and Fyb), Lutheran, MNS Unaffected: Kell People who have tested positive for an unexpected blood group antibody in the past may not exhibit a positive reaction on subsequent testing; however, if the antibody is clinically significant, they must be transfused with antigen-negative blood regardless.

alpha, beta amylases phosphorylases starch debranching enzyme (DBE) There are enzymes that are involved in the synthesis and degradation of amylopectin that have isoforms that display different relationships with proteins and other enzymes. For example, there are many versions of SS (starch synthase). Even the third isoform (SS-III) has two different versions. It is believed that SS-I and SS-II both have a role in elongating the chains of amylopectin branches. SS-IV is also thought to be responsible for the leaf-like structure of starch granule clusters.

ATC code H01 Pituitary and hypothalamic hormones and analogues is a therapeutic subgroup of the Anatomical Therapeutic Chemical Classification System, a system of alphanumeric codes developed by the World Health Organization (WHO) for the classification of drugs and other medical products. Subgroup H01 is part of the anatomical group H Systemic hormonal preparations, excluding sex hormones and insulins. Codes for veterinary use (ATCvet codes) can be created by placing the letter Q in front of the human ATC code: for example, QH01. ATCvet codes without corresponding human ATC codes are cited with the leading Q in the following list.National versions of the ATC classification may include additional codes not present in this list, which follows the WHO version. H01AA01 Corticotropin H01AA02 Tetracosactide H01AB01 Thyrotropin alfa H01AC01 Somatropin H01AC02 Somatrem H01AC03 Mecasermin H01AC04 Sermorelin H01AC05 Mecasermin rinfabate H01AC06 Tesamorelin H01AC07 Somapacitan H01AC08 Somatrogon H01AC09 Lonapegsomatropin H01AX01 Pegvisomant QH01AX90 Capromorelin

The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.

Sources: en.wikipedia.org

Frequently asked questions

What is TB-500?

TB-500 is a synthetic heptapeptide corresponding to a fragment of thymosin beta-4. It is used in laboratory research and is not an approved drug.

Is TB-500 identical to thymosin beta-4?

No. Thymosin beta-4 is a 43-amino-acid protein, while TB-500 represents only a short N-terminal segment. The two should not be treated as interchangeable in experimental design.

How does TB-500 appear in the literature?

It is often called a thymosin beta-4 fragment, Tβ4 fragment, or Ac-LKKTETQ. The name TB-500 is mainly a commercial or catalog label rather than a formal chemical name.

Is TB-500 identical to thymosin beta-4?

No. Thymosin beta-4 is a 43-residue protein, while TB-500 matches only residues 17 to 23 of that chain. The two are related but differ in size, and a method that identifies one does not automatically identify the other.

Network